PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_3458_iso_9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 305aa    MW: 35021.2 Da    PI: 7.7384
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_3458_iso_9genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072442762254
                                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_3458_iso_9_len_1348_ver_3 244 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 276
                                          59*****************************87 PP

2ELK29.41.8e-10197218122
                                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                          ELKh+L+++Y+++++++++E++
  cra_locus_3458_iso_9_len_1348_ver_3 197 ELKHELKQGYKEKIVDIREEIL 218
                                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.1E-202569IPR005540KNOX1
PfamPF037902.4E-172768IPR005540KNOX1
SMARTSM012562.0E-2585140IPR005541KNOX2
PfamPF037911.0E-1889139IPR005541KNOX2
SMARTSM011886.1E-4197218IPR005539ELK domain
PROSITE profilePS512139.969197217IPR005539ELK domain
PfamPF037896.6E-7197218IPR005539ELK domain
PROSITE profilePS5007111.677217280IPR001356Homeobox domain
SuperFamilySSF466894.28E-16219283IPR009057Homeodomain-like
SMARTSM003897.6E-11219284IPR001356Homeobox domain
CDDcd000862.16E-10220279No hitNo description
Gene3DG3DSA:1.10.10.603.2E-25224281IPR009057Homeodomain-like
PfamPF059207.5E-18237276IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MTLKVVVKKK EKNRNXKEKF EREREKCKAE ILNHPLYDQL LAAHVSCLRI ATPVDQLPRI  60
DAQLAQSQHV VAKYSAVLRS HGHDPQQQVL DDKDLDQFMT HYVLLLSSFK EQLQQHVRVH  120
AMEAVMACWE LEQSLQSLTG VAPSEGTGAT MSDDDDDQAD SDANLFDGGL DAQDSMGFGP  180
LTPTESERSL MERVRQELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSLLKAWWQS  240
HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSSSSSQKS KRKSAGEKSN  300
NEQFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12220285873Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.11e-177PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480001e-171KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A068UPN61e-179A0A068UPN6_COFCA; Uncharacterized protein
STRINGVIT_04s0008g06130.t011e-174(Vitis vinifera)